HPA002385

CLMP antibody from Sigma-Aldrich
ACAM, ASAM, FLJ22415
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002385
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002385, RRID:AB_1078222
Product name
Anti-AP000926.6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002385
Antibody type
Polyclonal
Antigen
Adipocyte adhesion molecule precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RKDKERYEEEERPNEIREDAEAPKARLVKPSSSSS
GSRSSRSGSSSTRSTANSASRSQRTLSTDAAPQPG
LATQAYSLVGPEVRGSEPKKVHHANLTKAETTPSM
Storage
-20C
Provider Type Product Number
- No reagents -