Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010544-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010544-M03, RRID:AB_464163
- Product name
- PROCR monoclonal antibody (M03), clone M2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PROCR.
- Antigen sequence
MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISY
FRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQL
QPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERT
LAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSF
VSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTR
YELREFLEDTCVQYVQKHISAENTKGSQTSRSYTS
LVLGVLVGGFIIAGVAVGIFLCTGGRRC- Isotype
- IgG
- Antibody clone number
- M2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Aspalathin and nothofagin from rooibos (Aspalathus linearis) inhibit endothelial protein C receptor shedding in vitro and in vivo.
Sulforaphane inhibits endothelial protein C receptor shedding in vitro and in vivo.
Rosmarinic acid down-regulates endothelial protein C receptor shedding in vitro and in vivo.
Emodin-6-O-β-D-glucoside down-regulates endothelial protein C receptor shedding.
Inhibitory effects of epi-sesamin on endothelial protein C receptor shedding in vitro and in vivo.
Down-regulation of endothelial protein C receptor shedding by persicarin and isorhamnetin-3-O-galactoside.
Kwak S, Han MS, Bae JS
Fitoterapia 2015 Jan;100:179-86
Fitoterapia 2015 Jan;100:179-86
Sulforaphane inhibits endothelial protein C receptor shedding in vitro and in vivo.
Ku SK, Han MS, Bae JS
Vascular pharmacology 2014 Oct;63(1):13-8
Vascular pharmacology 2014 Oct;63(1):13-8
Rosmarinic acid down-regulates endothelial protein C receptor shedding in vitro and in vivo.
Ku SK, Yang EJ, Song KS, Bae JS
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association 2013 Sep;59:311-5
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association 2013 Sep;59:311-5
Emodin-6-O-β-D-glucoside down-regulates endothelial protein C receptor shedding.
Lee W, Ku SK, Bae JS
Archives of pharmacal research 2013 Sep;36(9):1160-5
Archives of pharmacal research 2013 Sep;36(9):1160-5
Inhibitory effects of epi-sesamin on endothelial protein C receptor shedding in vitro and in vivo.
Ku SK, Lee W, Yoo H, Han CK, Bae JS
Inflammation research : official journal of the European Histamine Research Society ... [et al.] 2013 Oct;62(10):895-902
Inflammation research : official journal of the European Histamine Research Society ... [et al.] 2013 Oct;62(10):895-902
Down-regulation of endothelial protein C receptor shedding by persicarin and isorhamnetin-3-O-galactoside.
Ku SK, Han MS, Bae JS
Thrombosis research 2013 Jul;132(1):e58-63
Thrombosis research 2013 Jul;132(1):e58-63
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PROCR is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PROCR on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PROCR on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol