HPA020643

KIF24 antibody from Sigma-Aldrich
bA571F15.4, C9orf48, FLJ10933, FLJ43884
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020643
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020643, RRID:AB_2131749
Product name
Anti-KIF24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020643
Antibody type
Polyclonal
Antigen
Kinesin-like protein KIF24 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASWLYECLCEAELAQYYSHFTALGLQKIDELAKIT
MKDYSKLGVHDMNDRKRLFQLIKIIKIMQEEDKAV
SIPERHLQTSSLRIKSQELRSGPRRQLNFDSPADN
KDRNASNDGFEMCSLSDFSANEQKST
Storage
-20C
Provider Type Product Number
- No reagents -