HPA003927

LMAN2 antibody from Atlas Antibodies
C5orf8, GP36B, VIP36
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003927
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003927, RRID:AB_1079257
Product name
Anti-LMAN2
Provider product page
Atlas Antibodies - HPA003927
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTML
TSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHF
KVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDN
FHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSY
DHSKD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -