HPA003927

LMAN2 antibody from Sigma-Aldrich
C5orf8, GP36B, VIP36
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003927
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003927, RRID:AB_1079257
Product name
Anti-LMAN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003927
Antibody type
Polyclonal
Antigen
Vesicular integral-membrane protein VIP36 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTML
TSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHF
KVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDN
FHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSY
DHSKD
Storage
-20C
Provider Type Product Number
- No reagents -