Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183304 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger and SCAN Domain Containing 29 (ZSCAN29) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF690 antibody: synthetic peptide directed towards the middle region of human ZNF690
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
APVLFQSPRGFEAGFENEDNSKRDISEEVQLHRTL
LARSE RKIPRYLHQG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Congenital dyserythropoietic anemia type I is caused by mutations in codanin-1.
Dgany O, Avidan N, Delaunay J, Krasnov T, Shalmon L, Shalev H, Eidelitz-Markus T, Kapelushnik J, Cattan D, Pariente A, Tulliez M, Crétien A, Schischmanoff PO, Iolascon A, Fibach E, Koren A, Rössler J, Le Merrer M, Yaniv I, Zaizov R, Ben-Asher E, Olender T, Lancet D, Beckmann JS, Tamary H
American journal of human genetics 2002 Dec;71(6):1467-74
American journal of human genetics 2002 Dec;71(6):1467-74
No comments: Submit comment
No validations: Submit validation data