HPA007241

ZSCAN29 antibody from MilliporeSigma / Merck KGaA
FLJ35867, Zfp690, ZNF690
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007241
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007241, RRID:AB_10600420
Product name
Anti-ZSCAN29 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007241
Antibody type
Polyclonal
Antigen
zinc finger and SCAN domain containing 29 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSEAEAQKQAEEADEATEEDSDDDEEDTEIPPGAV
ITRAPVLFQSPRGFEAGFENEDNSKRDISEEVQLH
RTLLARSERKIPRYLHQGKGNESDCRSGRQWAKTS
GEKRGKLTLPEKSLSEVLSQQ
Storage
-20C
Provider Type Product Number
- No reagents -