HPA011109

ZSCAN29 antibody from Sigma-Aldrich
FLJ35867, Zfp690, ZNF690
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011109
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011109, RRID:AB_10611525
Product name
Anti-ZSCAN29 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011109
Antibody type
Polyclonal
Antigen
zinc finger and SCAN domain containing 29 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RTLEQCRTKFKGLQKSYRKVKSGHPPETCPFFEEM
EALMSAQVIALPSNGLEAAASHSGLVGSDAETEEP
GQRGWQHEEGAEEAVAQESDSDDMDLEATPQDPNS
AAPVVFRSPGGVHWGYEETKTYLAILSETQFYEAL
R
Storage
-20C
Provider Type Product Number
- No reagents -