Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA041976 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-CCKBR
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQN
GRCRPETGAVGEDSDGCYVQLPRSRPALELTALTA
PGPGSGSRPTQAKLLAKKRV- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Elevated Serum Gastrin Is Associated with Melanoma Progression: Putative Role in Increased Migration and Invasion of Melanoma Cells
Cell cycle dependent expression of the CCK2 receptor by gastrointestinal myofibroblasts: putative role in determining cell migration.
Varga A, Nemeth I, Kemeny L, Varga J, Tiszlavicz L, Kumar D, Dodd S, Simpson A, Buknicz T, Beynon R, Simpson D, Krenacs T, Dockray G, Varro A
International Journal of Molecular Sciences 2023;24(23):16851
International Journal of Molecular Sciences 2023;24(23):16851
Cell cycle dependent expression of the CCK2 receptor by gastrointestinal myofibroblasts: putative role in determining cell migration.
Varga A, Kumar JD, Simpson AWM, Dodd S, Hegyi P, Dockray GJ, Varro A
Physiological reports 2017 Oct;5(19)
Physiological reports 2017 Oct;5(19)
No comments: Submit comment
No validations: Submit validation data