Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007175-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007175-M01, RRID:AB_535081
- Product name
- TPR monoclonal antibody (M01), clone 1A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TPR.
- Antigen sequence
MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSE
IDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVN
ETRECQSLRLELEKLNNQLKALTEKNKE- Isotype
- IgG
- Antibody clone number
- 1A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Herpes simplex virus replication: roles of viral proteins and nucleoporins in capsid-nucleus attachment.
Quantitative analysis of human immunodeficiency virus type 1-infected CD4+ cell proteome: dysregulated cell cycle progression and nuclear transport coincide with robust virus production.
Copeland AM, Newcomb WW, Brown JC
Journal of virology 2009 Feb;83(4):1660-8
Journal of virology 2009 Feb;83(4):1660-8
Quantitative analysis of human immunodeficiency virus type 1-infected CD4+ cell proteome: dysregulated cell cycle progression and nuclear transport coincide with robust virus production.
Chan EY, Qian WJ, Diamond DL, Liu T, Gritsenko MA, Monroe ME, Camp DG 2nd, Smith RD, Katze MG
Journal of virology 2007 Jul;81(14):7571-83
Journal of virology 2007 Jul;81(14):7571-83
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TPR is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TPR on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol