HPA019661

TPR antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019661
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019661, RRID:AB_1858215
Product name
Anti-TPR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019661
Antibody type
Polyclonal
Antigen
Nucleoprotein TPR recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KMASVRQHLEETTQKAESQLLECKASWEERERMLK
DEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASV
KEGVQGPLNVSLSEEGKSQE
Storage
-20C
Provider Type Product Number
- No reagents -