PAB20223

SCFD1 antibody from Abnova Corporation
C14orf163, KIAA0917, RA410, SLY1, STXBP1L2

Antibody data

Product number
PAB20223
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20223, RRID:AB_10967114
Product name
SCFD1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20223
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SCFD1.
Antigen sequence
AALAASAVTQVAKVFDQYLNFITLEDDMFVLCNQN
KELVSYRAINRPDITDTEMETVMDTIVDSLFCFFV
TLGAVPIIRCSRGTAAEMVAVKLDKKLRENLRDAR
NSLFTGDTLGAGQFSFQRPL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -