ABIN503771
antibody from antibodies-online
Targeting: SCFD1
C14orf163, KIAA0917, RA410, SLY1, STXBP1L2
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503771 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Sec1 Family Domain Containing 1 (SCFD1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SCFD1 antibody: synthetic peptide directed towards the N terminal of human SCFD1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVS
YRAIN RPDITDTEME- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Large-scale characterization of HeLa cell nuclear phosphoproteins.
Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villén J, Li J, Cohn MA, Cantley LC, Gygi SP
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 17;101(33):12130-5
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 17;101(33):12130-5
No comments: Submit comment
No validations: Submit validation data