HPA003579

SCFD1 antibody from Atlas Antibodies
C14orf163, KIAA0917, RA410, SLY1, STXBP1L2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003579
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003579, RRID:AB_611767
Product name
Anti-SCFD1
Provider product page
Atlas Antibodies - HPA003579
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AALAASAVTQVAKVFDQYLNFITLEDDMFVLCNQN
KELVSYRAINRPDITDTEMETVMDTIVDSLFCFFV
TLGAVPIIRCSRGTAAEMVAVKLDKKLRENLRDAR
NSLFTGDTLGAGQFSFQRPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -