HPA003579

SCFD1 antibody from Sigma-Aldrich
C14orf163, KIAA0917, RA410, SLY1, STXBP1L2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003579
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003579, RRID:AB_1079872
Product name
Anti-SCFD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003579
Antibody type
Polyclonal
Antigen
Sec1 family domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AALAASAVTQVAKVFDQYLNFITLEDDMFVLCNQN
KELVSYRAINRPDITDTEMETVMDTIVDSLFCFFV
TLGAVPIIRCSRGTAAEMVAVKLDKKLRENLRDAR
NSLFTGDTLGAGQFSFQRPL
Storage
-20C
Provider Type Product Number
- No reagents -