Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003342 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003342, RRID:AB_1078588
- Product name
- Anti-CXADR
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIE
WLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRV
HFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAP
GVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A SNAIL1–SMAD3/4 transcriptional repressor complex promotes TGF-β mediated epithelial–mesenchymal transition
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Vincent T, Neve E, Johnson J, Kukalev A, Rojo F, Albanell J, Pietras K, Virtanen I, Philipson L, Leopold P, Crystal R, de Herreros A, Moustakas A, Pettersson R, Fuxe J
Nature Cell Biology 2009 July;11(8):943-950
Nature Cell Biology 2009 July;11(8):943-950
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN