HPA003342

CXADR antibody from Sigma-Aldrich
CAR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003342
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003342, RRID:AB_1078588
Product name
Anti-CXADR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003342
Antibody type
Polyclonal
Antigen
Coxsackievirus and adenovirus receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIE
WLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRV
HFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAP
GVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKI
Storage
-20C
Provider Type Product Number
- No reagents -