Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449851 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ADAM Metallopeptidase Domain 2 (ADAM2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the middle region of human ADAM2
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVV
LHPRTISLESLAVIL- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Functional classification of ADAMs based on a conserved motif for binding to integrin alpha 9beta 1: implications for sperm-egg binding and other cell interactions.
Eto K, Huet C, Tarui T, Kupriyanov S, Liu HZ, Puzon-McLaughlin W, Zhang XP, Sheppard D, Engvall E, Takada Y
The Journal of biological chemistry 2002 May 17;277(20):17804-10
The Journal of biological chemistry 2002 May 17;277(20):17804-10
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human 721_B; WB Suggested Anti-ADAM2 Antibody Titration: 0.2-1 ug/ml. Positive Control: 721_B cell lysate; ADAM2 antibody - middle region (AP43870PU-N) in Human 721_B cells using Western Blot