HPA024621

ADAM2 antibody from Sigma-Aldrich
CT15, FTNB, PH-30b, PH30
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024621
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024621, RRID:AB_1844576
Product name
Anti-ADAM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024621
Antibody type
Polyclonal
Antigen
Disintegrin and metalloproteinase domain-containing protein 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CENCLFMSKERMCRPSFEECDLPEYCNGSSASCPE
NHYVQTGHPCGLNQWICIDGVCMSGDK
Storage
-20C
Provider Type Product Number
- No reagents -