Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501659 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 36, C3H Type, Homolog (Mouse) (ZFP36) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZFP36 antibody: synthetic peptide directed towards the middle region of human ZFP36
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
PSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYA
SSGSS LGGSDSPVFE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of TTP mRNA targets in human dendritic cells reveals TTP as a critical regulator of dendritic cell maturation.
Emmons J, Townley-Tilson WH, Deleault KM, Skinner SJ, Gross RH, Whitfield ML, Brooks SA
RNA (New York, N.Y.) 2008 May;14(5):888-902
RNA (New York, N.Y.) 2008 May;14(5):888-902
No comments: Submit comment
No validations: Submit validation data