Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183636 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 36, C3H Type, Homolog (Mouse) (ZFP36) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZFP36 antibody: synthetic peptide directed towards the N terminal of human ZFP36
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSS
GPWSL SPSDSSPSGV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of the anti-inflammatory protein tristetraprolin as a hyperphosphorylated protein by mass spectrometry and site-directed mutagenesis.
Cao H, Deterding LJ, Venable JD, Kennington EA, Yates JR 3rd, Tomer KB, Blackshear PJ
The Biochemical journal 2006 Feb 15;394(Pt 1):285-97
The Biochemical journal 2006 Feb 15;394(Pt 1):285-97
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting