HPA006009

ZFP36 antibody from Sigma-Aldrich
G0S24, NUP475, RNF162A, TIS11, TTP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006009
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006009, RRID:AB_1859030
Product name
Anti-ZFP36 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006009
Antibody type
Polyclonal
Antigen
Tristetraproline recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSP
SSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCC
PSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYA
SSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFN
RISVS
Storage
-20C
Provider Type Product Number
- No reagents -