HPA003740

CD180 antibody from Sigma-Aldrich
LY64, Ly78, RP105
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003740
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003740, RRID:AB_1078450
Product name
Anti-CD180 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003740
Antibody type
Polyclonal
Antigen
CD180 antigen precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DFQNNAIHYISREDMRSLEQAINLSLNFNGNNVKG
IELGAFDSTVFQSLNFGGTPNLSVIFNGLQNSTTQ
SLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQE
HRFSDISSTTFQCFTQLQELDLTATHLKGLPSGMK
GLNLLKKL
Storage
-20C
Provider Type Product Number
- No reagents -