HPA019531

C22orf42 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019531
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019531, RRID:AB_1853016
Product name
Anti-C22orf42 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019531
Antibody type
Polyclonal
Antigen
Uncharacterized protein LOC150297 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSE
SLSVSLEDLMTPEMAKERYEDYLCWVKMARSRLNE
PISSQVLGLLR
Storage
-20C
Provider Type Product Number
- No reagents -