HPA026587

CDCA3 antibody from Sigma-Aldrich
GRCC8, TOME-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026587
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026587, RRID:AB_1846386
Product name
Anti-CDCA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026587
Antibody type
Polyclonal
Antigen
Cell division cycle-associated protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEEARQPTETPVASQSSDKPSRDPETPRSSGSMRN
RWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRP
SPLSENVSELKEGAILGTGRLLKTGGRAWEQ
Storage
-20C
Provider Type Product Number
- No reagents -