HPA026790

AC124319.2 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026790
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-RNF213 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026790
Antibody type
Polyclonal
Antigen
ring finger protein 213 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KDPVCLPCDHVHCLRCLRAWFASEQMICPYCLTAL
PDEFSPAVSQAHREAIEKHARFRQMCNSFFVDLVS
TICFKDNAPPEKEVIESLLSLLFVQKGRLRDAAQR
HCEHTKSLSPFNDVVDKTPVIRSVILKLLLKYS
Storage
-20C