HPA019338

FAM219A antibody from Sigma-Aldrich
bA573M23.5, C9orf25, FLJ39031
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019338
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019338, RRID:AB_1845819
Product name
Anti-C9orf25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019338
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf25 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEEIDRFQVPTAHSEMQPLDPAAASISDGDCDARE
GESVAMNYKPSPLQVKLEKQRELARKGSLKNGSM
Storage
-20C
Provider Type Product Number
- No reagents -