HPA019338

FAM219A antibody from Atlas Antibodies
bA573M23.5, C9orf25, FLJ39031
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019338
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019338, RRID:AB_1845819
Product name
Anti-FAM219A
Provider product page
Atlas Antibodies - HPA019338
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MEEIDRFQVPTAHSEMQPLDPAAASISDGDCDARE
GESVAMNYKPSPLQVKLEKQRELARKGSLKNGSM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -