HPA004795

SLC10A2 antibody from Sigma-Aldrich
ASBT, ISBT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004795
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004795, RRID:AB_1856953
Product name
Anti-SLC10A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004795
Antibody type
Polyclonal
Antigen
Ileal sodium/bile acid cotransporter recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKAEIPESKENGTEPESSFYKANGGFQPDE
Storage
-20C
Provider Type Product Number
- No reagents -