HPA027213

GGT6 antibody from Sigma-Aldrich
FLJ90165
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027213
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027213, RRID:AB_10601326
Product name
Anti-GGT6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027213
Antibody type
Polyclonal
Antigen
gamma-glutamyltransferase 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEPVVYQKLLPWEPSLESEEEVEEEETSEALVLNP
RRHQDSSRNKAGGLPGTWVRVVAALLLLAVGCSLA
VRQLQNQGRS
Storage
-20C
Provider Type Product Number
- No reagents -