HPA025706

SMTNL2 antibody from Sigma-Aldrich
FLJ42461
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025706
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025706, RRID:AB_1848935
Product name
Anti-SMTNL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025706
Antibody type
Polyclonal
Antigen
Smoothelin-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSFTWSVPSSGYGAVTASKHSNSPPLVTPPQSPVS
PQPPAITQVHRQGERRRELVRSQTLPRTSEAQARK
ALFEKWEQETAAGKGKGEARARLKRS
Storage
-20C
Provider Type Product Number
- No reagents -