ABIN971929

TRIM3 antibody from antibodies-online
BERP, HAC1, RNF22, RNF97

Antibody data

Product number
ABIN971929
Provider
antibodies-online
Product name
anti-Tripartite Motif Containing 3 (TRIM3) (Middle Region) antibody
Provider product page
antibodies-online - ABIN971929
Antibody type
Polyclonal
Antigen
The immunogen for anti-TRIM3 antibody: synthetic peptide directed towards the middle region of human TRIM3
Reactivity
Human
Host
Rabbit
Antigen sequence
VKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKD
NPIED ELVFRVGSRG
Vial size
50ug
Provider Type Product Number
- No reagents -