HPA005516

DDX20 antibody from Sigma-Aldrich
DP103, GEMIN3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005516
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005516, RRID:AB_1849612
Product name
Anti-DDX20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005516
Antibody type
Polyclonal
Antigen
Probable ATP-dependent RNA helicase DDX20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDV
PLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEENM
MMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVK
AAVHTYGIASVPNQPLKKQIQKIERTLQIQKAHGD
H
Storage
-20C
Provider Type Product Number
- No reagents -