HPA017998

FOXK1 antibody from Sigma-Aldrich
IMAGE:5164497
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017998
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017998, RRID:AB_1849077
Product name
Anti-FOXK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017998
Antibody type
Polyclonal
Antigen
Forkhead box protein K1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVIMA
VPPRPSSLVAKPVAYMPASIVTSQQPAGHAIHVVQ
QAPTVTMVRVVTTSANSANGYILTSQGAAGGSHDA
AGAAVLDLGSEARGLEEKPTIAFATIPAAGGVIQT
VA
Storage
-20C
Provider Type Product Number
- No reagents -