Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183628 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SATB Homeobox 1 (SATB1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SATB1 antibody: synthetic peptide directed towards the C terminal of human SATB1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
VDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEE
LSVEG NTDINTDLKD- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Phosphorylation of SATB1, a global gene regulator, acts as a molecular switch regulating its transcriptional activity in vivo.
Definition of a novel promoter for the major adenovirus-associated virus mRNA.
Pavan Kumar P, Purbey PK, Sinha CK, Notani D, Limaye A, Jayani RS, Galande S
Molecular cell 2006 Apr 21;22(2):231-43
Molecular cell 2006 Apr 21;22(2):231-43
Definition of a novel promoter for the major adenovirus-associated virus mRNA.
Green MR, Roeder RG
Cell 1980 Nov;22(1 Pt 1):231-42
Cell 1980 Nov;22(1 Pt 1):231-42
No comments: Submit comment
No validations: Submit validation data