HPA021843

DNAI1 antibody from Sigma-Aldrich
CILD1, DIC1, PCD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021843
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021843, RRID:AB_1847914
Product name
Anti-DNAI1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021843
Antibody type
Polyclonal
Antigen
Dynein intermediate chain 1, axonemal recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLS
QAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQ
VGTLLPLWKFQNDKAKRLSVTALCW
Storage
-20C
Provider Type Product Number
- No reagents -