Antibody data

Product number
H00084727-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084727-B01, RRID:AB_982605
Product name
SPSB2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00084727-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SPSB2 protein.
Antigen sequence
MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSA
PPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRP
VAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAV
VGVATALAPLQTDHYAALLGSNSESWGWDIGRGKL
YHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEE
GTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQC
QVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLG
QVSALPLPPAMKRYLLYQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -