Antibody data

Product number
ABIN786218
Provider
antibodies-online
Product name
anti-SplA/ryanodine Receptor Domain and SOCS Box Containing 2 (SPSB2) (C-Term) antibody
Provider product page
antibodies-online - ABIN786218
Antibody type
Polyclonal
Antigen
The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the C terminal of human SPSB2
Reactivity
Human
Host
Rabbit
Antigen sequence
IGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLV
VLDME EGTLGYAIGG
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -