HPA002632

SND1 antibody from Atlas Antibodies
p100, TDRD11
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002632
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002632, RRID:AB_1857316
Product name
Anti-SND1
Provider product page
Atlas Antibodies - HPA002632
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDA
VDSVVRDIQNTQCLLNVEHLSAGCPHVTLQFADSK
GDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQE
SAKSARLNLWRYGDFRADDADEF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -