Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182607 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Staphylococcal Nuclease Domain Containing Protein 1 (SND1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SND1 antibody: synthetic peptide directed towards the N terminal of human SND1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAE
AKFFT ESRLLQRDVQ- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of p100 as a coactivator for STAT6 that bridges STAT6 with RNA polymerase II.
Yang J, Aittomäki S, Pesu M, Carter K, Saarinen J, Kalkkinen N, Kieff E, Silvennoinen O
The EMBO journal 2002 Sep 16;21(18):4950-8
The EMBO journal 2002 Sep 16;21(18):4950-8
No comments: Submit comment
No validations: Submit validation data