HPA002529

SND1 antibody from Sigma-Aldrich
p100, TDRD11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002529
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002529, RRID:AB_1857317
Product name
Anti-SND1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002529
Antibody type
Polyclonal
Antigen
Staphylococcal nuclease domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFL
PFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITF
LLAGIECPRGARNLPGLVQEGEPFSEEATLFTKEL
Storage
-20C
Provider Type Product Number
- No reagents -