Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486999 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RB-Associated KRAB Zinc Finger (RBAK) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RBAK antibody: synthetic peptide directed towards the N terminal of human RBAK
- Description
- Affinity Purified
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
VMLENYSHLVSVGYDTTKPNVIIKLEQGEEPWIMG
GEFPC QHSPEAWRVD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Examination of chromosome 7p22 candidate genes RBaK, PMS2 and GNA12 in familial hyperaldosteronism type II.
Jeske YW, So A, Kelemen L, Sukor N, Willys C, Bulmer B, Gordon RD, Duffy D, Stowasser M
Clinical and experimental pharmacology & physiology 2008 Apr;35(4):380-5
Clinical and experimental pharmacology & physiology 2008 Apr;35(4):380-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting