HPA016586

KCNH8 antibody from Sigma-Aldrich
elk3, Kv12.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016586
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016586, RRID:AB_1852127
Product name
Anti-KCNH8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016586
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily H member 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SEVTTLTQEVSQLGKDMRNVIQLLENVLSPQQPSR
FCSLHSTSVCPSRESLQTRTSWSAHQPCLHLQTGG
AAYTQAQLCSSNITSDIWSVDPSSVGSSPQRTGAH
EQNPADSELYHSPSLDYSPSHYQVVQEGHL
Storage
-20C
Provider Type Product Number
- No reagents -