HPA019852

WIPI2 antibody from Atlas Antibodies
ATG18B, ATG21, CGI-50, DKFZP434J154, DKFZp686P02188, FLJ12979, FLJ14217, FLJ42984
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019852
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019852, RRID:AB_1846589
Product name
Anti-WIPI2
Provider product page
Atlas Antibodies - HPA019852
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ECALMKQHRLDGSLETTNEILDSASHDCPLVTQTY
GAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEA
SALRLDEDSEHPPMILRTD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -