HPA019852

WIPI2 antibody from Sigma-Aldrich
ATG18B, Atg21, CGI-50, DKFZP434J154, DKFZp686P02188, FLJ12979, FLJ14217, FLJ42984
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019852
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019852, RRID:AB_1846589
Product name
Anti-WIPI2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019852
Antibody type
Polyclonal
Antigen
WD repeat domain phosphoinositide-interacting protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ECALMKQHRLDGSLETTNEILDSASHDCPLVTQTY
GAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEA
SALRLDEDSEHPPMILRTD
Storage
-20C
Provider Type Product Number
- No reagents -