H00006790-M01
antibody from Abnova Corporation
Targeting: AURKA
AIK, ARK1, AurA, BTAK, PPP1R47, STK15, STK6, STK7
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006790-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006790-M01, RRID:AB_489866
- Product name
- AURKA monoclonal antibody (M01), clone 5F8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STK6.
- Antigen sequence
MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQN
PLPVNSGQAQRVLCPSNSSQRIPLQAQKLVSSHKP
VQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSA
PENNP- Isotype
- IgG
- Antibody clone number
- 5F8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references KIBRA protein phosphorylation is regulated by mitotic kinase aurora and protein phosphatase 1.
Aurora Kinase A expression is associated with lung cancer histological-subtypes and with tumor de-differentiation.
Xiao L, Chen Y, Ji M, Volle DJ, Lewis RE, Tsai MY, Dong J
The Journal of biological chemistry 2011 Oct 21;286(42):36304-15
The Journal of biological chemistry 2011 Oct 21;286(42):36304-15
Aurora Kinase A expression is associated with lung cancer histological-subtypes and with tumor de-differentiation.
Lo Iacono M, Monica V, Saviozzi S, Ceppi P, Bracco E, Papotti M, Scagliotti GV
Journal of translational medicine 2011 Jun 30;9:100
Journal of translational medicine 2011 Jun 30;9:100
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STK6 monoclonal antibody (M01), clone 5F8 Western Blot analysis of STK6 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STK6 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to STK6 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to AURKA on formalin-fixed paraffin-embedded human prostate. [antibody concentration 6 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol