HPA002636

AURKA antibody from Atlas Antibodies
AIK, ARK1, AurA, BTAK, PPP1R47, STK15, STK6, STK7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002636
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002636, RRID:AB_1845217
Product name
Anti-AURKA
Provider product page
Atlas Antibodies - HPA002636
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQ
AQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQ
LQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEE
LASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVY
L
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -