HPA002636

AURKA antibody from Sigma-Aldrich
AIK, ARK1, AurA, BTAK, PPP1R47, STK15, STK6, STK7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002636
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002636, RRID:AB_1845217
Product name
Anti-AURKA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002636
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQ
AQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQ
LQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEE
LASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVY
L
Storage
-20C
Provider Type Product Number
- No reagents -