Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502151 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chemokine (C-X-C Motif) Ligand 16 (CXCL16) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CXCL16 antibody: synthetic peptide directed towards the C terminal of human CXCL16
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQ
SPQSS PDLPVHYIPV- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The role of CXCL16 and its processing metalloproteinases ADAM10 and ADAM17 in the proliferation and migration of human mesangial cells.
Schramme A, Abdel-Bakky MS, Kämpfer-Kolb N, Pfeilschifter J, Gutwein P
Biochemical and biophysical research communications 2008 May 30;370(2):311-6
Biochemical and biophysical research communications 2008 May 30;370(2):311-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting