HPA002730

BAZ1A antibody from Atlas Antibodies
ACF1, hACF1, WALp1, WCRF180
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002730
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002730, RRID:AB_1078269
Product name
Anti-BAZ1A
Provider product page
Atlas Antibodies - HPA002730
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RGHRESALKETLLQEKSRICAQLARFSEEKFHFSD
KPQPDSKPTYSRGRSSNAYDPSQMCAEKQLELRLR
DFLLDIEDRIYQGTLGAIKVTDRHIWRSALESGRY
ELLSEENKENGIIKTVNEDVEEMEIDEQTK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -